• Gene id: 131920

Gene Summary

• Gene Symbol: TMEM207   Gene   UCSC   Ensembl
• Aliases: UNQ846
• Gene name: transmembrane protein 207
• Alternate names: transmembrane protein 207, SRSR846,
• Gene location: 3q28 (190449875: 190428654)     Exons: 5     NC_000003.12
• OMIM: 142240

Protein Summary

• Protein general information: Q6UWW9  
  • Name: Transmembrane protein 207
  • Length: 146  
  • Mass: 16116
  • Tissue specificity: Expressed in some signet-ring cell carcinoma, especially those showing high invasion and metastatic activity (at protein level). {ECO
• Sequence:

  MSRSRLFSVTSAISTIGILCLPLFQLVLSDLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQC
  WLRRPRIDSHRRTMAVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT

• Structural information:
  • Interpro: IPR039490  
  • STRING: ENSP00000346981
• Other Databases: GeneCards:  TMEM207  Malacards:  TMEM207

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq