• Gene id: 131870

Gene Summary

• Gene Symbol: NUDT16   Gene   UCSC   Ensembl
• Gene name: nudix hydrolase 16
• Alternate names: U8 snoRNA-decapping enzyme, IDP phosphatase, IDPase, U8 snoRNA-binding protein H29K, inosine diphosphate phosphatase, m7GpppN-mRNA hydrolase, nucleoside diphosphate-linked moiety X motif 16, nudix (nucleoside diphosphate linked moiety X)-type motif 16, nudix moti,
• Gene location: 3q22.1 (131381670: 131388829)     Exons: 4     NC_000003.12
• OMIM: 617381

Protein Summary

• Protein general information: Q96DE0  
  • Name: U8 snoRNA decapping enzyme (EC 3.6.1.62) (IDP phosphatase) (IDPase) (EC 3.6.1.64) (Inosine diphosphate phosphatase) (Nucleoside diphosphate linked moiety X motif 16) (Nudix motif 16) (Nudix hydrolase 16) (U8 snoRNA binding protein H29K) (m7GpppN mRNA hydr
  • Length: 195  
  • Mass: 21273
  • Tissue specificity: Expressed strongly in lung, kidney, adrenal gland, testis, heart and brain. {ECO
• Sequence:

  MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGGFVDTQDRSLEDGLNR
  ELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRAKDHGLEVLGLVRVPLYTLRD
  GVGGLPTFLENSFIGSAREQLLEALQDLGLLQSGSISGLKIPAHH

• Structural information:
  • Protein Domains: (18..17-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR015797  IPR000086  
  • Prosite: PS51462
  • PDB: 2XSQ 3COU 3MGM 5VY2 5W6X 5W6Z 5WJI 6B09 6CO2
  • PDBsum: 2XSQ 3COU 3MGM 5VY2 5W6X 5W6Z 5WJI 6B09 6CO2
  • STRING: ENSP00000422375
• Other Databases: GeneCards:  NUDT16  Malacards:  NUDT16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016077	snoRNA catabolic process	IBA	biological process
GO:0030515	snoRNA binding	IBA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006402	mRNA catabolic process	IBA	biological process
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	IBA	molecular function
GO:1990174	phosphodiesterase decapping endonuclease activity	IBA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0050072	m7G(5')pppN diphosphatase activity	IDA	molecular function
GO:0046709	IDP catabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030515	snoRNA binding	IDA	molecular function
GO:0030515	snoRNA binding	IDA	molecular function
GO:0030145	manganese ion binding	IDA	molecular function
GO:0030145	manganese ion binding	IDA	molecular function
GO:0016077	snoRNA catabolic process	IDA	biological process
GO:0016077	snoRNA catabolic process	IDA	biological process
GO:0016077	snoRNA catabolic process	IDA	biological process
GO:0016077	snoRNA catabolic process	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:1901641	ITP binding	IDA	molecular function
GO:1901640	XTP binding	IDA	molecular function
GO:1901639	XDP catabolic process	IDA	biological process
GO:0050897	cobalt ion binding	IDA	molecular function
GO:0008235	metalloexopeptidase activity	IDA	molecular function
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035863	dITP catabolic process	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0006382	adenosine to inosine editing	IMP	biological process
GO:2000781	positive regulation of double-strand break repair	IMP	biological process
GO:2000233	negative regulation of rRNA processing	ISS	biological process
GO:0090068	positive regulation of cell cycle process	IMP	biological process
GO:0035870	dITP diphosphatase activity	ISS	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034656	nucleobase-containing small molecule catabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	IDA	molecular function
GO:0031404	chloride ion binding	IDA	molecular function
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:1990174	phosphodiesterase decapping endonuclease activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa03018	RNA degradation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq