• Gene id: 1318

Gene Summary

• Gene Symbol: SLC31A2   Gene   UCSC   Ensembl
• Aliases: COPT2, CTR2, hCTR2
• Gene name: solute carrier family 31 member 2
• Alternate names: probable low affinity copper uptake protein 2, copper transporter 2, solute carrier family 31 (copper transporter), member 2, solute carrier family 31 (copper transporters), member 2,
• Gene location: 9q32 (38297022: 38323217)     Exons: 8     NC_000017.11
• OMIM: 603088

Protein Summary

• Protein general information: O15432  
  • Name: Probable low affinity copper uptake protein 2 (Copper transporter 2) (hCTR2) (Solute carrier family 31 member 2)
  • Length: 143  
  • Mass: 15681
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSA
  GSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA

• Structural information:
  • Interpro: IPR007274  
  • STRING: ENSP00000259392
• Other Databases: GeneCards:  SLC31A2  Malacards:  SLC31A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006878	cellular copper ion homeostasis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005375	copper ion transmembrane transporter activity	IEA	molecular function
GO:0035434	copper ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006825	copper ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005375	copper ion transmembrane transporter activity	TAS	molecular function
GO:0006825	copper ion transport	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0006878	cellular copper ion homeostasis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1902311	regulation of copper ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)