• Gene id: 1317

Gene Summary

• Gene Symbol: SLC31A1   Gene   UCSC   Ensembl
• Aliases: COPT1, CTR1
• Gene name: solute carrier family 31 member 1
• Alternate names: high affinity copper uptake protein 1, copper transport 1 homolog, copper transporter 1, solute carrier family 31 (copper transporter), member 1, solute carrier family 31 (copper transporters), member 1,
• Gene location: 9q32 (113221543: 113264491)     Exons: 5     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. [provided by RefSeq, Aug 2011]
• OMIM: 618100

Protein Summary

• Protein general information: O15431  
  • Name: High affinity copper uptake protein 1 (Copper transporter 1) (hCTR1) (Solute carrier family 31 member 1)
  • Length: 190  
  • Mass: 21091
• Sequence:

  MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVA
  VFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLM
  LIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH

• Structural information:
  • Interpro: IPR007274  
  • PDB: 2LS2 2LS3 2LS4
  • PDBsum: 2LS2 2LS3 2LS4
  • DIP: 48727
  • STRING: ENSP00000363329
• Other Databases: GeneCards:  SLC31A1  Malacards:  SLC31A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005375	copper ion transmembrane transporter activity	IBA	molecular function
GO:0006878	cellular copper ion homeostasis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005375	copper ion transmembrane transporter activity	IEA	molecular function
GO:0035434	copper ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006825	copper ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005375	copper ion transmembrane transporter activity	TAS	molecular function
GO:0006825	copper ion transport	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005375	copper ion transmembrane transporter activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005375	copper ion transmembrane transporter activity	IEA	molecular function
GO:0072719	cellular response to cisplatin	IEA	biological process
GO:0098705	copper ion import across plasma membrane	IEA	biological process
GO:0005375	copper ion transmembrane transporter activity	IEA	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015677	copper ion import	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0006878	cellular copper ion homeostasis	IEA	biological process
GO:0015677	copper ion import	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881