• Gene id: 1316

Gene Summary

• Gene Symbol: KLF6   Gene   UCSC   Ensembl
• Aliases: BCD1, CBA1, COPEB, CPBP, GBF, PAC1, ST12, ZF9
• Gene name: Kruppel like factor 6
• Alternate names: Krueppel-like factor 6, B-cell-derived protein 1, GC-rich binding factor, GC-rich sites-binding factor GBF, Kruppel-like zinc finger protein Zf9, core promoter element-binding protein, proto-oncogene BCD1, protooncogene B-cell derived 1, suppression of tumorigeni,
• Gene location: 10p15.2 (3785280: 3775995)     Exons: 4     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this
• OMIM: 146790

Protein Summary

• Protein general information: Q99612  
  • Name: Krueppel like factor 6 (B cell derived protein 1) (Core promoter element binding protein) (GC rich sites binding factor GBF) (Proto oncogene BCD1) (Suppressor of tumorigenicity 12 protein) (Transcription factor Zf9)
  • Length: 283  
  • Mass: 31865
  • Tissue specificity: Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.
• Sequence:

  MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKE
  ESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPS
  SPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHT
  GEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000419923
• Other Databases: GeneCards:  KLF6  Malacards:  KLF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0030183	B cell differentiation	NAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	TAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	TAS	biological process

Diseases

Associated diseases	References
Prostate cancer	PMID:11752579
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881