• Gene id: 131405

Gene Summary

• Gene Symbol: TRIM71   Gene   UCSC   Ensembl
• Aliases: HYDCC1, LIN-41, LIN41
• Gene name: tripartite motif containing 71
• Alternate names: E3 ubiquitin-protein ligase TRIM71, RING-type E3 ubiquitin transferase TRIM71, abnormal cell LINeage LIN-41, homolog of C. elegans Lin-41, protein lin-41 homolog, tripartite motif containing 71, E3 ubiquitin protein ligase, tripartite motif-containing protein 7,
• Gene location: 3p22.3 (32817996: 32897823)     Exons: 4     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is an E3 ubiquitin-protein ligase that binds with miRNAs and maintains the growth and upkeep of embryonic stem cells. This gene also is involved in the G1-S phase transition of the cell cycle. [provided by RefSeq, Dec 2015
• OMIM: 618570

Protein Summary

• Protein general information: Q2Q1W2  
  • Name: E3 ubiquitin protein ligase TRIM71 (EC 2.3.2.27) (Protein lin 41 homolog) (RING type E3 ubiquitin transferase TRIM71) (Tripartite motif containing protein 71)
  • Length: 868  
  • Mass: 93385
  • Tissue specificity: Specifically expressed in testis. {ECO
• Sequence:

  MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLPCLHAFCRPCLEAHRL
  PAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATADEPPPKNGRAGAPAGAGGHSNHR
  HHAHHAHPRASASAPPLPQAPQPPAPSRSAPGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVR
  AHQRVRLTKDHYIERGPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
  CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVVQSEVKAVTARHKKAL
  EERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQVLEEGRALDILLARDRMLAQVQELKTVRSL
  LQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMS
  AVVLGPDGNLFGAEVSDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
  DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNH
  RIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSP
  RGVAFNHEGHLVVTDFNNHRLLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNG
  SFLCKFGAQGSGFGQMDRPSGIAITPDGMIVVVDFGNNRILVF

• Structural information:
  • Interpro: IPR011042  IPR017868  IPR001298  IPR013783  IPR014756   IPR001258  IPR013017  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50194 PS51125 PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000373272
• Other Databases: GeneCards:  TRIM71  Malacards:  TRIM71

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030371	translation repressor activity	IDA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030371	translation repressor activity	IBA	molecular function
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:2000177	regulation of neural precursor cell proliferation	ISS	biological process
GO:0072089	stem cell proliferation	ISS	biological process
GO:0035198	miRNA binding	ISS	molecular function
GO:0021915	neural tube development	ISS	biological process
GO:0010586	miRNA metabolic process	ISS	biological process
GO:0004842	ubiquitin-protein transferase activity	ISS	molecular function
GO:0000932	P-body	ISS	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	ISS	biological process
GO:0060964	regulation of gene silencing by miRNA	ISS	biological process
GO:0051865	protein autoubiquitination	ISS	biological process
GO:0035278	miRNA mediated inhibition of translation	ISS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035196	production of miRNAs involved in gene silencing by miRNA	IMP	biological process
GO:0010608	posttranscriptional regulation of gene expression	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:2000637	positive regulation of gene silencing by miRNA	IEA	biological process
GO:2000177	regulation of neural precursor cell proliferation	IEA	biological process
GO:0072089	stem cell proliferation	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0035198	miRNA binding	IEA	molecular function
GO:0021915	neural tube development	IEA	biological process
GO:0010586	miRNA metabolic process	IEA	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0060964	regulation of gene silencing by miRNA	IEA	biological process
GO:0051865	protein autoubiquitination	IEA	biological process
GO:0051246	regulation of protein metabolic process	IEA	biological process
GO:0035278	miRNA mediated inhibition of translation	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0001843	neural tube closure	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)