• Gene id: 1311

Gene Summary

• Gene Symbol: COMP   Gene   UCSC   Ensembl
• Aliases: EDM1, EPD1, MED, PSACH, THBS5, TSP5
• Gene name: cartilage oligomeric matrix protein
• Alternate names: cartilage oligomeric matrix protein, cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple), pseudoachondroplasia (epiphyseal dysplasia 1, multiple), thrombospondin-5,
• Gene location: 19p13.11 (18791304: 18782772)     Exons: 19     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a
• OMIM: 613012

Protein Summary

• Protein general information: P49747  
  • Name: Cartilage oligomeric matrix protein (COMP) (Thrombospondin 5) (TSP5)
  • Length: 757  
  • Mass: 82860
  • Tissue specificity: Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the m
• Sequence:

  MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQ
  QSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFR
  CEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRA
  QRFCPDGSPSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
  EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDI
  DGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSRDNCPT
  VPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAE
  VTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
  FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVG
  WKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYE
  THQLRQA

• Structural information:
  • Protein Domains: (87..12-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (127..17-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (180..22-)
    (/note="EGF-like-)
    (-)
    (/evid-)
  • Interpro: IPR013320  IPR001881  IPR013032  IPR000742  IPR018097   IPR009030  IPR024665  IPR003367  IPR017897  IPR008859  IPR028492  IPR039081  IPR028974  
  • Prosite: PS01186 PS50026 PS01187 PS51234 PS51236
  • CDD: cd16077
  • PDB: 3FBY
  • PDBsum: 3FBY
  • STRING: ENSP00000222271
• Other Databases: GeneCards:  COMP  Malacards:  COMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0060173	limb development	IDA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0005518	collagen binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005201	extracellular matrix structural constituent	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0031012	extracellular matrix	TAS	cellular component
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0043394	proteoglycan binding	IDA	molecular function
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051216	cartilage development	IEA	biological process
GO:0050905	neuromuscular process	IEA	biological process
GO:0036122	BMP binding	IEA	molecular function
GO:0035989	tendon development	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0016485	protein processing	IEA	biological process
GO:0014829	vascular smooth muscle contraction	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0003417	growth plate cartilage development	IEA	biological process
GO:0003416	endochondral bone growth	IEA	biological process
GO:0002063	chondrocyte development	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:1902732	positive regulation of chondrocyte proliferation	IEA	biological process
GO:1900047	negative regulation of hemostasis	IEA	biological process
GO:0098868	bone growth	IEA	biological process
GO:0097084	vascular smooth muscle cell development	IEA	biological process
GO:0070527	platelet aggregation	IEA	biological process
GO:0060349	bone morphogenesis	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0050881	musculoskeletal movement	IEA	biological process
GO:0048844	artery morphogenesis	IEA	biological process
GO:0048747	muscle fiber development	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0035988	chondrocyte proliferation	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030500	regulation of bone mineralization	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0030199	collagen fibril organization	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0010260	animal organ senescence	IEA	biological process
GO:0010259	multicellular organism aging	IEA	biological process
GO:0009306	protein secretion	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0002020	protease binding	IEA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005576	extracellular region	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa04145	Phagosome
hsa04512	ECM-receptor interaction
hsa05144	Malaria

Diseases

Associated diseases	References
Multiple epiphyseal dysplasia	KEGG:H00476
Pseudoachondroplasia	KEGG:H00477
Multiple epiphyseal dysplasia	KEGG:H00476
Pseudoachondroplasia	KEGG:H00477
Osteochondrodysplasia	PMID:7670472
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray