• Gene id: 130951

Gene Summary

• Gene Symbol: M1AP   Gene   UCSC   Ensembl
• Aliases: C2orf65, D6Mm5e, SPATA37
• Gene name: meiosis 1 associated protein
• Alternate names: meiosis 1 arrest protein, meiosis 1 arresting protein, spermatogenesis associated 37,
• Gene location: 2p13.1 (74648337: 74557639)     Exons: 15     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by

Protein Summary

• Protein general information: Q8TC57  
  • Name: Meiosis 1 arrest protein (Meiosis 1 arresting protein) (Meiosis 1 associated protein) (Spermatogenesis associated protein 37)
  • Length: 530  
  • Mass: 59386
• Sequence:

  MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHEC
  ILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTSLEITILTSQP
  GKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQTIDNDIVSMEIFFKA
  WLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGSLRMDDPKGDFITLYQMASQS
  SASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHFHALCHSLLKREWLLLAKGEPPGPGH
  SQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHDDSLKNVESMLDSLELEPTYNPLHVQSHLYS
  HLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARATVAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEK
  DPSRP

• Structural information:
  • Interpro: IPR033587  
  • STRING: ENSP00000290536
• Other Databases: GeneCards:  M1AP  Malacards:  M1AP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007283	spermatogenesis	IBA	biological process
GO:0051308	male meiosis chromosome separation	IBA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0051308	male meiosis chromosome separation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0007127	meiosis I	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0051308	male meiosis chromosome separation	IEA	biological process
GO:0007292	female gamete generation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007283	spermatogenesis	ISS	biological process
GO:0006396	RNA processing	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007292	female gamete generation	ISS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0031497	chromatin assembly	NAS	biological process

Diseases

Associated diseases	References
Oligozoospermia	MIK: 32017041

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
32017041	Oligozoospermia	c.1435-1G>A	Han Chi nese	226 (1 case, 225 controls)	Male infertility