• Gene id: 130916

Gene Summary

• Gene Symbol: MTERF4   Gene   UCSC   Ensembl
• Aliases: MTERFD2
• Gene name: mitochondrial transcription termination factor 4
• Alternate names: transcription termination factor 4, mitochondrial, MTERF domain-containing protein 2,
• Gene location: 2q37.3 (241102331: 241072167)     Exons: 10     NC_000002.12
• OMIM: 603667

Protein Summary

• Protein general information: Q7Z6M4  
  • Name: Transcription termination factor 4, mitochondrial (Mitochondrial transcription termination factor 4) (mTERF domain containing protein 2) [Cleaved into: mTERF domain containing protein 2 processed]
  • Length: 381  
  • Mass: 43958
• Sequence:

  MAAFGRQVLDWHRLIPLTWACMARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSCVRSNNYVQEPECRRNLVQ
  CLLEKQGTPVVQGSLELERVMSSLLDMGFSNAHINELLSVRRGASLQQLLDIISEFILLGLNPEPVCVVLKKSPQ
  LLKLPIMQMRKRSSYLQKLGLGEGKLKRVLYCCPEIFTMRQQDINDTVRLLKEKCLFTVQQVTKILHSCPSVLRE
  DLGQLEYKFQYAYFRMGIKHPDIVKSEYLQYSLTKIKQRHIYLERLGRYQTPDKKGQTQIPNPLLKDILRVSEAE
  FLARTACTSVEEFQVFKKLLAREEEESESSTSDDKRASLDEDEDDDDEEDNDEDDNDEDDDDEDDDEAEDNDEDE
  DDDEEE

• Structural information:
  • Interpro: IPR003690  IPR038538  
  • PDB: 4FP9 4FZV
  • PDBsum: 4FP9 4FZV
  • DIP: 49918
  • STRING: ENSP00000480378
• Other Databases: GeneCards:  MTERF4  Malacards:  MTERF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006390	mitochondrial transcription	IBA	biological process
GO:0061668	mitochondrial ribosome assembly	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0019843	rRNA binding	IDA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0031167	rRNA methylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006390	mitochondrial transcription	IEA	biological process
GO:0006626	protein targeting to mitochondrion	IEA	biological process
GO:0043010	camera-type eye development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0042255	ribosome assembly	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881