• Gene id: 130617

Gene Summary

• Gene Symbol: ZFAND2B   Gene   UCSC   Ensembl
• Aliases: AIRAPL
• Gene name: zinc finger AN1-type containing 2B
• Alternate names: AN1-type zinc finger protein 2B, AIRAP-like protein, arsenite-inducible RNA-associated protein-like protein, zinc finger, AN1-type domain 2B,
• Gene location: 2q35 (219206781: 219209650)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants
• OMIM: 613474

Protein Summary

• Protein general information: Q8WV99  
  • Name: AN1 type zinc finger protein 2B (Arsenite inducible RNA associated protein like protein) (AIRAP like protein)
  • Length: 257  
  • Mass: 28023
• Sequence:

  MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGEPPDRA
  VGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAIS
  RAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEED
  LALAQALSASEAEYQRQQAQSRSSKPSNCSLC

• Structural information:
  • Protein Domains: (197..21-)
    (/note="UIM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213-)
    (221..24-)
    (/note="UIM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213"-)
  • Interpro: IPR035896  IPR003903  IPR000058  
  • Prosite: PS50330 PS51039
  • PDB: 1X4V
  • PDBsum: 1X4V
  • STRING: ENSP00000289528
• Other Databases: GeneCards:  ZFAND2B  Malacards:  ZFAND2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000502	proteasome complex	IDA	colocalizes with
GO:0036435	K48-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045047	protein targeting to ER	IMP	biological process
GO:0031225	anchored component of membrane	ISS	cellular component
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	ISS	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031593	polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0045047	protein targeting to ER	IEA	biological process
GO:0043567	regulation of insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0036435	K48-linked polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0000502	proteasome complex	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881