• Gene id: 130576

Gene Summary

• Gene Symbol: LYPD6B   Gene   UCSC   Ensembl
• Aliases: CT116, LYPD7
• Gene name: LY6/PLAUR domain containing 6B
• Alternate names: ly6/PLAUR domain-containing protein 6B, cancer/testis antigen 116,
• Gene location: 2q23.2 (149038466: 149215261)     Exons: 14     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q8NI32  
  • Name: Ly6/PLAUR domain containing protein 6B
  • Length: 183  
  • Mass: 20656
• Sequence:

  MLYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCN
  RWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTN
  AVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL

• Structural information:
  • Protein Domains: (60..15-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR039457  
  • STRING: ENSP00000387077
• Other Databases: GeneCards:  LYPD6B  Malacards:  LYPD6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030548	acetylcholine receptor regulator activity	IBA	molecular function
GO:0030548	acetylcholine receptor regulator activity	IDA	molecular function
GO:0030548	acetylcholine receptor regulator activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)