• Gene id: 130574

Gene Summary

• Gene Symbol: LYPD6   Gene   UCSC   Ensembl
• Gene name: LY6/PLAUR domain containing 6
• Alternate names: ly6/PLAUR domain-containing protein 6,
• Gene location: 2q23.2 (55717746: 55760208)     Exons: 12     NC_000023.11
• Gene summary(Entrez): Members of the LY6 protein family (see SLURP1; MIM 606119), such as LYPD6, have at least one 80-amino acid LU domain that contains 10 conserved cysteines with a defined disulfide-bonding pattern (Zhang et al., 2010 [PubMed 19653121]).[supplied by OMIM, Ap
• OMIM: 613359

Protein Summary

• Protein general information: Q86Y78  
  • Name: Ly6/PLAUR domain containing protein 6
  • Length: 171  
  • Mass: 19118
  • Tissue specificity: Ubiquitous. Highly expressed in brain and heart. {ECO
• Sequence:

  MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETR
  YCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTN
  GHPRCMSVIVSCLWLWLGLML

• Structural information:
  • Protein Domains: (47..14-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR031574  IPR039457  
  • PDB: 6GBI 6IB6
  • PDBsum: 6GBI 6IB6
  • STRING: ENSP00000334463
• Other Databases: GeneCards:  LYPD6  Malacards:  LYPD6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030550	acetylcholine receptor inhibitor activity	IBA	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0030548	acetylcholine receptor regulator activity	IBA	molecular function
GO:0030550	acetylcholine receptor inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030548	acetylcholine receptor regulator activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030548	acetylcholine receptor regulator activity	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0030550	acetylcholine receptor inhibitor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process
GO:0099601	regulation of neurotransmitter receptor activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq