• Gene id: 130340

Gene Summary

• Gene Symbol: AP1S3   Gene   UCSC   Ensembl
• Aliases: PSORS15
• Gene name: adaptor related protein complex 1 subunit sigma 3
• Alternate names: AP-1 complex subunit sigma-3, adapter-related protein complex 1 subunit sigma-1C, adaptor protein complex AP-1 sigma-1C subunit, adaptor related protein complex 1 sigma 3 subunit, adaptor-related protein complex 1 subunit sigma-1C, clathrin assembly protein co,
• Gene location: 2q36.1 (223837581: 223755325)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the adaptor-related protein complex 1, sigma subunit genes. The encoded protein is a component of adaptor protein complex 1 (AP-1), one of the AP complexes involved in claathrin-mediated vesicular transport from the Golgi or
• OMIM: 615781

Protein Summary

• Protein general information: Q96PC3  
  • Name: AP 1 complex subunit sigma 3 (Adaptor protein complex AP 1 subunit sigma 1C) (Adaptor related protein complex 1 subunit sigma 1C) (Clathrin assembly protein complex 1 sigma 1C small chain) (Golgi adaptor HA1/AP1 adaptin sigma 1C subunit) (Sigma 1C subunit
  • Length: 154  
  • Mass: 18280
  • Tissue specificity: Widely expressed.
• Sequence:

  MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQD
  NELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQEVSTVSQT
  MGER

• Structural information:
  • Interpro: IPR016635  IPR022775  IPR000804  IPR011012  
  • Prosite: PS00989
  • PDB: 4HMY 6CM9 6CRI 6D83 6D84 6DFF
  • PDBsum: 4HMY 6CM9 6CRI 6D83 6D84 6DFF
  • STRING: ENSP00000379891
• Other Databases: GeneCards:  AP1S3  Malacards:  AP1S3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0006605	protein targeting	IMP	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0030117	membrane coat	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection
hsa04142	Lysosome

Diseases

Associated diseases	References
Psoriasis	KEGG:H01656
Psoriasis	KEGG:H01656
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq