• Gene id: 130120

Gene Summary

• Gene Symbol: REG3G   Gene   UCSC   Ensembl
• Aliases: LPPM429, PAP IB, PAP-1B, PAP1B, PAPIB, REG III, REG-III, UNQ429
• Gene name: regenerating family member 3 gamma
• Alternate names: regenerating islet-derived protein 3-gamma, REG-3-gamma, pancreatitis-associated protein 1B, pancreatitis-associated protein IB, reg III-gamma, regenerating gene III, regenerating islet-derived 3 gamma, regenerating islet-derived protein III-gamma,
• Gene location: 2p12 (79025663: 79028501)     Exons: 7     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobia
• OMIM: 609933

Protein Summary

• Protein general information: Q6UW15  
  • Name: Regenerating islet derived protein 3 gamma (REG 3 gamma) (Pancreatitis associated protein 1B) (PAP 1B) (Pancreatitis associated protein IB) (PAP IB) (Regenerating islet derived protein III gamma) (REG III) (Reg III gamma) [Cleaved into: Regenerating islet
  • Length: 175  
  • Mass: 19330
  • Tissue specificity: Predominantly expressed in pancreas, where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart, kidney and placenta. {ECO
• Sequence:

  MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGK
  LVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLS
  RSTGFLKWKDYNCDAKLPYVCKFKD

• Structural information:
  • Protein Domains: (47..17-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  
  • Prosite: PS00615 PS50041
  • STRING: ENSP00000272324
• Other Databases: GeneCards:  REG3G  Malacards:  REG3G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0070492	oligosaccharide binding	IBA	molecular function
GO:0044278	cell wall disruption in other organism	IBA	biological process
GO:0043434	response to peptide hormone	IBA	biological process
GO:0042834	peptidoglycan binding	IBA	molecular function
GO:0090303	positive regulation of wound healing	ISS	biological process
GO:0050830	defense response to Gram-positive bacterium	ISS	biological process
GO:0045617	negative regulation of keratinocyte differentiation	ISS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	ISS	biological process
GO:0010838	positive regulation of keratinocyte proliferation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0006953	acute-phase response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0044278	cell wall disruption in other organism	IDA	biological process
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0051838	cytolysis by host of symbiont cells	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R