• Gene id: 130075

Gene Summary

• Gene Symbol: OR9A4   Gene   UCSC   Ensembl
• Gene name: olfactory receptor family 9 subfamily A member 4
• Alternate names: olfactory receptor 9A4, olfactory receptor OR7-1,
• Gene location: 7q34 (141918816: 141919908)     Exons: 1     NC_000007.14
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Protein Summary

• Protein general information: Q8NGU2  
  • Name: Olfactory receptor 9A4 (Olfactory receptor OR7 1)
  • Length: 314  
  • Mass: 35758
• Sequence:

  MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYFFLGHLSALEILVTTI
  IVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAVDRYVAVCNPLRYNIIMNRHTCNFVVLVSWV
  FGFLFQIWPVYVMFQLTYCKSNVVNNFFCDRGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTI
  LKIPSSSGRRKSFSTCASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA
  LRDGVKRCCQLFRN

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000448789
• Other Databases: GeneCards:  OR9A4  Malacards:  OR9A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007608	sensory perception of smell	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)