• Gene id: 130074

Gene Summary

• Gene Symbol: FAM168B   Gene   UCSC   Ensembl
• Aliases: MANI
• Gene name: family with sequence similarity 168 member B
• Alternate names: myelin-associated neurite-outgrowth inhibitor, protein FAM168B,
• Gene location: 2q21.1 (131093467: 131047875)     Exons: 12     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: A1KXE4  
  • Name: Myelin associated neurite outgrowth inhibitor (Mani) (p20)
  • Length: 195  
  • Mass: 20324
  • Tissue specificity: Expressed in the brain, within neuronal axonal fibers and associated with myelin sheets (at protein level). Expression tends to be lower in the brain of Alzheimer disease patients compared to healthy individuals (at protein level). {EC
• Sequence:

  MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSS
  SPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGNGVTMGMVA
  GTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW

• Structural information:
  • Interpro: IPR029247  
  • STRING: ENSP00000387051
• Other Databases: GeneCards:  FAM168B  Malacards:  FAM168B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq