• Gene id: 129831

Gene Summary

• Gene Symbol: RBM45   Gene   UCSC   Ensembl
• Aliases: DRB1, RB-1
• Gene name: RNA binding motif protein 45
• Alternate names: RNA-binding protein 45, developmentally regulated RNA-binding protein 1, putative RNA binding protein RB-1,
• Gene location: 2q31.2 (178112408: 178129655)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the RNA recognition motif (RRM)-type RNA-binding family of proteins. This protein exhibits preferential binding to poly(C) RNA. Initial cloning of this gene found that the rat ortholog was dynamically expressed in the develop
• OMIM: 608888

Protein Summary

• Protein general information: Q8IUH3  
  • Name: RNA binding protein 45 (Developmentally regulated RNA binding protein 1) (RB 1) (RNA binding motif protein 45)
  • Length: 476  
  • Mass: 53502
• Sequence:

  MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFAR
  SSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEEDLREKFKVYGDIEYCS
  IIKNKVTGESKGLGYVRYLKPSQAAQAIENCDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFV
  GEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAI
  YAKYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVAAQLASMVWNNPSQQQFMQFGGSSGSQLPQIQTDV
  VLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVYLVSGKNVGYAKYADRISANDAIATLHGK
  ILNGVRLKVMLADSPREESNKRQRTY

• Structural information:
  • Protein Domains: (26..10-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (121..19-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (392..46-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR034203  IPR034206  IPR034207   IPR034208  IPR000504  
  • Prosite: PS50102
  • CDD: cd12366 cd12367 cd12368 cd12369
  • STRING: ENSP00000286070
• Other Databases: GeneCards:  RBM45  Malacards:  RBM45

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0007399	nervous system development	ISS	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)