• Gene id: 129563

Gene Summary

• Gene Symbol: DIS3L2   Gene   UCSC   Ensembl
• Aliases: FAM6A, PRLMNS, hDIS3L2
• Gene name: DIS3 like 3'-5' exoribonuclease 2
• Alternate names: DIS3-like exonuclease 2, DIS3 mitotic control homolog-like 2, family with sequence similarity 6, member A,
• Gene location: 2q37.1 (231961582: 232344349)     Exons: 21     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is similar in sequence to 3'/5' exonucleolytic subunits of the RNA exosome. The exosome is a large multimeric ribonucleotide complex responsible for degrading various RNA substrates. Several transcript variants, some prote
• OMIM: 611551

Protein Summary

• Protein general information: Q8IYB7  
  • Name: DIS3 like exonuclease 2 (hDIS3L2) (EC 3.1.13. )
  • Length: 885  
  • Mass: 99279
• Sequence:

  MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIFETYMSKEDVSEGLKRGTLIQGVLRI
  NPKKFHEAFIPSPDGDRDIFIDGVVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHL
  PQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKGREDGDAPVTKDETTCISQDTRALS
  EKSLQRSAKVVYILEKKHSRAATGFLKLLADKNSELFRKYALFSPSDHRVPRIYVPLKDCPQDFVARPKDYANTL
  FICRIVDWKEDCNFALGQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSEVLECLPQGLPWTIPPEEFSKRRDLR
  KDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEGSDLDKVAAERATSVYLVQKVVPMLPRLLCE
  ELCSLNPMSDKLTFSVIWTLTPEGKILDEWFGRTIIRSCTKLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEV
  HQAVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRA
  FPEQALLRRHPPPQTRMLSDLVEFCDQMGLPVDFSSAGALNKSLTQTFGDDKYSLARKEVLTNMCSRPMQMALYF
  CSGLLQDPAQFRHYALNVPLYTHFTSPIRRFADVLVHRLLAAALGYRERLDMAPDTLQKQADHCNDRRMASKRVQ
  ELSTSLFFAVLVKESGPLESEAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDM
  EQEPAQQVITIFSLVEVVLQAESTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS

• Structural information:
  • Interpro: IPR041505  IPR028591  IPR041093  IPR012340  IPR001900   IPR022966  IPR033771  
  • Prosite: PS01175
  • STRING: ENSP00000315569
• Other Databases: GeneCards:  DIS3L2  Malacards:  DIS3L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0006402	mRNA catabolic process	IBA	biological process
GO:0000178	exosome (RNase complex)	IBA	cellular component
GO:0000932	P-body	IBA	cellular component
GO:0010587	miRNA catabolic process	IBA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0010587	miRNA catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0010587	miRNA catabolic process	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0000278	mitotic cell cycle	IMP	biological process
GO:1990074	polyuridylation-dependent mRNA catabolic process	ISS	biological process
GO:0051306	mitotic sister chromatid separation	IMP	biological process
GO:0019827	stem cell population maintenance	ISS	biological process
GO:0005844	polysome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000291	nuclear-transcribed mRNA catabolic process, exonucleolytic	IMP	biological process
GO:0000175	3'-5'-exoribonuclease activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004540	ribonuclease activity	IEA	molecular function
GO:0034427	nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5'	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0010587	miRNA catabolic process	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0008266	poly(U) RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0010587	miRNA catabolic process	IEA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IEA	molecular function
GO:1990074	polyuridylation-dependent mRNA catabolic process	IEA	biological process
GO:0000291	nuclear-transcribed mRNA catabolic process, exonucleolytic	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

Diseases

Associated diseases	References
Perlman syndrome	KEGG:H01412
Perlman syndrome	KEGG:H01412
nephroblastoma	PMID:22306653
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq