• Gene id: 129531

Gene Summary

• Gene Symbol: MITD1   Gene   UCSC   Ensembl
• Gene name: microtubule interacting and trafficking domain containing 1
• Alternate names: MIT domain-containing protein 1, MIT, microtubule interacting and transport, domain containing 1,
• Gene location: 2q11.2 (99181060: 99161426)     Exons: 18     NC_000002.12
• Gene summary(Entrez): Abscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of

Protein Summary

• Protein general information: Q8WV92  
  • Name: MIT domain containing protein 1
  • Length: 249  
  • Mass: 29314
• Sequence:

  MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENI
  KKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKT
  IHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGY
  CDFDLRPCHETTVDIFHKKHTKNI

• Structural information:
  • Protein Domains: (8..8-)
    (/note="MIT"-)
  • Interpro: IPR007330  IPR032341  IPR038113  IPR036181  
  • CDD: cd02683 cd02685
  • PDB: 2YMB 4A5X 4A5Z
  • PDBsum: 2YMB 4A5X 4A5Z
  • STRING: ENSP00000289359
• Other Databases: GeneCards:  MITD1  Malacards:  MITD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0030496	midbody	IDA	colocalizes with
GO:0061952	midbody abscission	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0051301	cell division	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031902	late endosome membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0039702	viral budding via host ESCRT complex	IMP	NOT|biological process
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0035091	phosphatidylinositol binding	IMP	molecular function
GO:0030496	midbody	IMP	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061952	midbody abscission	IMP	biological process
GO:0071985	multivesicular body sorting pathway	IMP	NOT|biological process
GO:0071985	multivesicular body sorting pathway	IMP	NOT|biological process
GO:0032091	negative regulation of protein binding	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881