• Gene id: 129401

Gene Summary

• Gene Symbol: NUP35   Gene   UCSC   Ensembl
• Aliases: MP-44, MP44, NP44, NUP53
• Gene name: nucleoporin 35
• Alternate names: nucleoporin NUP35, mitotic phosphoprotein 44, nuclear pore complex protein Nup53, nucleoporin 35kDa, nucleoporin NUP53,
• Gene location: 2q32.1 (183117479: 183161683)     Exons: 14     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the nucleoporin family. The encoded protein contains two membrane binding regions, is localized to the nuclear rim, and is part of the nuclear pore complex. All molecules entering or leaving the nucleus either diffuse through
• OMIM: 608140

Protein Summary

• Protein general information: Q8NFH5  
  • Name: Nucleoporin NUP35 (35 kDa nucleoporin) (Mitotic phosphoprotein 44) (MP 44) (Nuclear pore complex protein Nup53) (Nucleoporin NUP53)
  • Length: 326  
  • Mass: 34774
• Sequence:

  MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPP
  QPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTL
  SPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKAL
  SKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
  QVISDRQTPKKDESLVSKAMEYMFGW

• Structural information:
  • Protein Domains: (170..25-)
    (/note="RRM-Nup35-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00804"-)
  • Interpro: IPR017389  IPR012677  IPR035979  IPR007846  
  • Prosite: PS51472
  • PDB: 4LIR
  • PDBsum: 4LIR
  • DIP: 47308
  • STRING: ENSP00000295119
• Other Databases: GeneCards:  NUP35  Malacards:  NUP35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006607	NLS-bearing protein import into nucleus	IBA	biological process
GO:0017056	structural constituent of nuclear pore	IBA	molecular function
GO:0044613	nuclear pore central transport channel	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0005543	phospholipid binding	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0006999	nuclear pore organization	IBA	biological process
GO:0044615	nuclear pore nuclear basket	IBA	cellular component
GO:0017056	structural constituent of nuclear pore	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005652	nuclear lamina	IEA	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043657	host cell	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881