• Gene id: 129303

Gene Summary

• Gene Symbol: TMEM150A   Gene   UCSC   Ensembl
• Aliases: TM6P1, TMEM150, TTN1
• Gene name: transmembrane protein 150A
• Alternate names: transmembrane protein 150A, fasting-inducible integral membrane protein TM6P1, tentonin 1, transmembrane protein 150,
• Gene location: 2p11.2 (85602698: 85598546)     Exons: 11     NC_000002.12
• OMIM: 612203

Protein Summary

• Protein general information: Q86TG1  
  • Name: Transmembrane protein 150A (Transmembrane protein 150)
  • Length: 271  
  • Mass: 28835
• Sequence:

  MTAWILLPVSLSAFSITGIWTVYAMAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYPPE
  SCLFSLIGNMGAFMVALICLLRYGQLLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLHYVGAGVAFPA
  GLLFVCLHCALSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHESSQLQHGAALCEWVCVIDILIFYGTF
  SYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI

• Structural information:
  • Interpro: IPR019402  IPR027315  
  • STRING: ENSP00000387292
• Other Databases: GeneCards:  TMEM150A  Malacards:  TMEM150A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046854	phosphatidylinositol phosphorylation	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009056	catabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881