• Gene id: 128989

Gene Summary

• Gene Symbol: TANGO2   Gene   UCSC   Ensembl
• Aliases: C22orf25, MECRCN
• Gene name: transport and golgi organization 2 homolog
• Alternate names: transport and Golgi organization protein 2 homolog,
• Gene location: 22q11.21 (20016999: 20067163)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene belongs to the transport and Golgi organization family, whose members are predicted to play roles in secretory protein loading in the endoplasmic reticulum. Depletion of this gene in Drosophila S2 cells causes fusion of the Golgi with the ER. In
• OMIM: 614912

Protein Summary

• Protein general information: Q6ICL3  
  • Name: Transport and Golgi organization protein 2 homolog
  • Length: 276  
  • Mass: 30937
• Sequence:

  MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGLDMEEGKEGGTWLGISTRGKLAALTN
  YLQPQLDWQARGRGELVTHFLTTDVDSLSYLKKVSMEGHLYNGFNLIAADLSTAKGDVICYYGNRGEPDPIVLTP
  GTYGLSNALLETPWRKLCFGKQLFLEAVERSQALPKDVLIASLLDVLNNEEAQLPDPAIEDQGGEYVQPMLSKYA
  AVCVRCPGYGTRTNTIILVDADGHVTFTERSMMDKDLSHWETRTYEFTLQS

• Structural information:
  • Interpro: IPR008551  
  • STRING: ENSP00000403645
• Other Databases: GeneCards:  TANGO2  Malacards:  TANGO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0009306	protein secretion	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq