• Gene id: 128866

Gene Summary

• Gene Symbol: CHMP4B   Gene   UCSC   Ensembl
• Aliases: C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
• Gene name: charged multivesicular body protein 4B
• Alternate names: charged multivesicular body protein 4b, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, chromatin modifying protein 4B, chromatin-modifying protein 4b, hSnf7-2, hVps32-2, vacuolar protein-sorting-associated protein 32-2,
• Gene location: 20q11.22 (33811347: 33854365)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the so
• OMIM: 610897

Protein Summary

• Protein general information: Q9H444  
  • Name: Charged multivesicular body protein 4b (Chromatin modifying protein 4b) (CHMP4b) (SNF7 homolog associated with Alix 1) (SNF7 2) (hSnf7 2) (Vacuolar protein sorting associated protein 32 2) (Vps32 2) (hVps32 2)
  • Length: 224  
  • Mass: 24950
  • Tissue specificity: Widely expressed. Expressed at higher level in heart and skeletal muscle. Also expressed in brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood lymphocytes. {ECO
• Sequence:

  MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRY
  EKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTAIS
  KPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM

• Structural information:
  • Interpro: IPR005024  
  • PDB: 3C3Q 3UM3 4ABM 5MK2
  • PDBsum: 3C3Q 3UM3 4ABM 5MK2
  • DIP: 29924
  • STRING: ENSP00000217402
• Other Databases: GeneCards:  CHMP4B  Malacards:  CHMP4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006914	autophagy	IMP	biological process
GO:0006914	autophagy	TAS	biological process
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0000815	ESCRT III complex	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0039702	viral budding via host ESCRT complex	TAS	biological process
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0005771	multivesicular body	IBA	cellular component
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway	IBA	biological process
GO:0006900	vesicle budding from membrane	IBA	biological process
GO:0000815	ESCRT III complex	IBA	cellular component
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0090148	membrane fission	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010458	exit from mitosis	IMP	biological process
GO:0031468	nuclear envelope reassembly	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007034	vacuolar transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0010506	regulation of autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0031982	vesicle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0051258	protein polymerization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0030117	membrane coat	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0039702	viral budding via host ESCRT complex	IDA	biological process
GO:0000815	ESCRT III complex	IDA	cellular component
GO:1902902	negative regulation of autophagosome assembly	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0039702	viral budding via host ESCRT complex	IGI	biological process
GO:1902188	positive regulation of viral release from host cell	IMP	biological process
GO:1901215	negative regulation of neuron death	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050792	regulation of viral process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0039702	viral budding via host ESCRT complex	IGI	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0060548	negative regulation of cell death	IMP	biological process
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0061952	midbody abscission	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006997	nucleus organization	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0036438	maintenance of lens transparency	IMP	biological process
GO:0046755	viral budding	IMP	biological process
GO:0010824	regulation of centrosome duplication	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04217	Necroptosis

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881