• Gene id: 128853

Gene Summary

• Gene Symbol: DUSP15   Gene   UCSC   Ensembl
• Aliases: C20orf57, VHY
• Gene name: dual specificity phosphatase 15
• Alternate names: dual specificity protein phosphatase 15, VH1-related member Y, dual specificity phosphatase-like 15, vaccinia virus VH1-related dual-specific protein phosphatase Y,
• Gene location: 20q11.21 (31870743: 31845577)     Exons: 18     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocyt
• OMIM: 616776

Protein Summary

• Protein general information: Q9H1R2  
  • Name: Dual specificity protein phosphatase 15 (EC 3.1.3.16) (EC 3.1.3.48) (VH1 related member Y) (Vaccinia virus VH1 related dual specific protein phosphatase Y)
  • Length: 295  
  • Mass: 31882
  • Tissue specificity: Highly expressed in testis (PubMed
• Sequence:

  MTEGVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCR
  LNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSK
  TSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGE
  EDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRAASSSCTR

• Structural information:
  • Protein Domains: (62..13-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR000340  IPR029021  IPR008984  IPR016130   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 1YZ4
  • PDBsum: 1YZ4
  • STRING: ENSP00000341658
• Other Databases: GeneCards:  DUSP15  Malacards:  DUSP15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R