• Gene id: 128434

Gene Summary

• Gene Symbol: VSTM2L   Gene   UCSC   Ensembl
• Aliases: C20orf102, dJ1118M15.2
• Gene name: V-set and transmembrane domain containing 2 like
• Alternate names: V-set and transmembrane domain-containing protein 2-like protein,
• Gene location: 20q11.23 (37903103: 37945349)     Exons: 4     NC_000020.11
• OMIM: 609085

Protein Summary

• Protein general information: Q96N03  
  • Name: V set and transmembrane domain containing protein 2 like protein
  • Length: 204  
  • Mass: 22349
• Sequence:

  MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLE
  IQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDG
  KARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL

• Structural information:
  • Protein Domains: (41..15-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106   IPR027115  
  • Prosite: PS50835
  • STRING: ENSP00000362560
• Other Databases: GeneCards:  VSTM2L  Malacards:  VSTM2L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070593	dendrite self-avoidance	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0098632	cell-cell adhesion mediator activity	IBA	molecular function
GO:0007411	axon guidance	IBA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq