• Gene id: 128414

Gene Summary

• Gene Symbol: NKAIN4   Gene   UCSC   Ensembl
• Aliases: C20orf58, FAM77A, bA261N11.2
• Gene name: sodium/potassium transporting ATPase interacting 4
• Alternate names: sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4, Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4, Na+/K+ transporting ATPase interacting 4,
• Gene location: 20q13.33 (63256405: 63240779)     Exons: 10     NC_000020.11
• Gene summary(Entrez): NKAIN4 is a member of a family of mammalian proteins (see NKAIN1; MIM 612871) with similarity to Drosophila Nkain and interacts with the beta subunit of Na,K-ATPase (ATP1B1; MIM 182330) (Gorokhova et al., 2007 [PubMed 17606467]).[supplied by OMIM, Jun 200
• OMIM: 612873

Protein Summary

• Protein general information: Q8IVV8  
  • Name: Sodium/potassium transporting ATPase subunit beta 1 interacting protein 4 (Na(+)/K(+) transporting ATPase subunit beta 1 interacting protein 4) (Protein FAM77A)
  • Length: 208  
  • Mass: 23240
• Sequence:

  MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLRYVMVYTLWAAVWVTW
  NVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVPAVGLGAPHGQALVSGAGCALEPSYVEALHS
  CLQILIALLGFVCGCQVVSVFTEEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLPA

• Structural information:
  • Interpro: IPR008516  
  • STRING: ENSP00000359340
• Other Databases: GeneCards:  NKAIN4  Malacards:  NKAIN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002028	regulation of sodium ion transport	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq