• Gene id: 128344

Gene Summary

• Gene Symbol: PIFO   Gene   UCSC   Ensembl
• Aliases: C1orf88, pitchfork
• Gene name: primary cilia formation
• Alternate names: protein pitchfork,
• Gene location: 1p13.2 (111324662: 111353016)     Exons: 7     NC_000001.11
• OMIM: 614234

Protein Summary

• Protein general information: Q8TCI5  
  • Name: Protein pitchfork
  • Length: 191  
  • Mass: 21973
• Sequence:

  MCFSRADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDGYGLAYDLSKIPTSIKGYTLGA
  RTAVRFKPIQKEMTPHAGRYQKVSPQQEKHKQNFAPFNVLVPRFKNYPKDTYYPSPGAYNPEKKPPPKIAWPMKF
  GSPDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN

• Structural information:
  • Interpro: IPR033602  
  • STRING: ENSP00000358753
• Other Databases: GeneCards:  PIFO  Malacards:  PIFO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031344	regulation of cell projection organization	IBA	biological process
GO:0008092	cytoskeletal protein binding	IBA	molecular function
GO:0036064	ciliary basal body	IBA	cellular component
GO:0048487	beta-tubulin binding	IDA	molecular function
GO:0043015	gamma-tubulin binding	IDA	molecular function
GO:0036064	ciliary basal body	ISS	cellular component
GO:0033674	positive regulation of kinase activity	IMP	biological process
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0005802	trans-Golgi network	ISS	cellular component
GO:0031344	regulation of cell projection organization	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019894	kinesin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0048487	beta-tubulin binding	IEA	molecular function
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0031344	regulation of cell projection organization	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019894	kinesin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)