• Gene id: 128308

Gene Summary

• Gene Symbol: MRPL55   Gene   UCSC   Ensembl
• Aliases: AAVG5835, L55nt, MRP-L55, PRO19675
• Gene name: mitochondrial ribosomal protein L55
• Alternate names: 39S ribosomal protein L55, mitochondrial, L55mt, mitochondrial large ribosomal subunit protein bL31m, mitochondrial large ribosomal subunit protein mL55,
• Gene location: 1q42.13 (228111745: 228106678)     Exons: 5     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611859

Protein Summary

• Protein general information: Q7Z7F7  
  • Name: 39S ribosomal protein L55, mitochondrial (L55mt) (MRP L55) (Mitochondrial large ribosomal subunit protein bL31m) (Mitochondrial large ribosomal subunit protein mL55)
  • Length: 128  
  • Mass: 15128
• Sequence:

  MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRML
  AMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

• Structural information:
  • Interpro: IPR018615  
  • PDB: 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000403614
• Other Databases: GeneCards:  MRPL55  Malacards:  MRPL55

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	ISS	cellular component
GO:0006412	translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881