• Gene id: 127733

Gene Summary

• Gene Symbol: UBXN10   Gene   UCSC   Ensembl
• Aliases: UBXD3
• Gene name: UBX domain protein 10
• Alternate names: UBX domain-containing protein 10, UBX domain containing 3, UBX domain-containing protein 3,
• Gene location: 1p36.12 (20183006: 20196049)     Exons: 4     NC_000001.11
• OMIM: 616783

Protein Summary

• Protein general information: Q96LJ8  
  • Name: UBX domain containing protein 10 (UBX domain containing protein 3)
  • Length: 280  
  • Mass: 30811
• Sequence:

  MATEAPVNIAPPECSTVVSTAVDSLIWQPNSLNMHMIRPKSAKGRTRPSLQKSQGVEVCAHHIPSPPPAIPYELP
  SSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSINRKNLEEEAVETVAKKASSLQLSSIRALYQ
  DETGTMKTSEEDSRARACAVERKFIVRTKKQGSSRAGNLEEPSDQEPRLLLAVRSPTGQRFVRHFRPTDDLQTIV
  AVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGWP

• Structural information:
  • Protein Domains: (194..27-)
    (/note="UBX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00215"-)
  • Interpro: IPR029071  IPR001012  
  • Prosite: PS50033
  • STRING: ENSP00000364240
• Other Databases: GeneCards:  UBXN10  Malacards:  UBXN10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IDA	biological process
GO:0005929	cilium	IDA	cellular component
GO:0030992	intraciliary transport particle B	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R