• Gene id: 127435

Gene Summary

• Gene Symbol: PODN   Gene   UCSC   Ensembl
• Aliases: PCAN, SLRR5A
• Gene name: podocan
• Alternate names: podocan, podocan proteoglycan,
• Gene location: 1p32.3 (53062197: 53085501)     Exons: 13     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the small leucine-rich repeat protein family and contains an amino terminal CX3CXCX7C cysteine-rich cluster followed by a leucine-rich repeat domain. Studies suggest that this protein could function to inhib
• OMIM: 605425

Protein Summary

• Protein general information: Q7Z5L7  
  • Name: Podocan
  • Length: 613  
  • Mass: 68976
  • Tissue specificity: Kidney, heart, liver, pancreas and vascular smooth muscle cells. Also detected in aortic intima (at protein level). {ECO
• Sequence:

  MAQSRVLLLLLLLPPQLHLGPVLAVRAPGFGRSGGHSLSPEENEFAEEEPVLVLSPEEPGPGPAAVSCPRDCACS
  QEGVVDCGGIDLREFPGDLPEHTNHLSLQNNQLEKIYPEELSRLHRLETLNLQNNRLTSRGLPEKAFEHLTNLNY
  LYLANNKLTLAPRFLPNALISVDFAANYLTKIYGLTFGQKPNLRSVYLHNNKLADAGLPDNMFNGSSNVEVLILS
  SNFLRHVPKHLPPALYKLHLKNNKLEKIPPGAFSELSSLRELYLQNNYLTDEGLDNETFWKLSSLEYLDLSSNNL
  SRVPAGLPRSLVLLHLEKNAIRSVDANVLTPIRSLEYLLLHSNQLREQGIHPLAFQGLKRLHTVHLYNNALERVP
  SGLPRRVRTLMILHNQITGIGREDFATTYFLEELNLSYNRITSPQVHRDAFRKLRLLRSLDLSGNRLHTLPPGLP
  RNVHVLKVKRNELAALARGALVGMAQLRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGNQLTEIPEGLPESLE
  YLYLQNNKISAVPANAFDSTPNLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEGNLEFGDISKDRGRLGKEKE
  EEEEEEEEEEETR

• Structural information:
  • Protein Domains: (59..9-)
    (/note="LRRNT"-)
  • Interpro: IPR001611  IPR003591  IPR026906  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000308315
• Other Databases: GeneCards:  PODN  Malacards:  PODN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005518	collagen binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R