• Gene id: 127281

Gene Summary

• Gene Symbol: PRXL2B   Gene   UCSC   Ensembl
• Aliases: C1orf93, FAM213B
• Gene name: peroxiredoxin like 2B
• Alternate names: prostamide/prostaglandin F synthase, family with sequence similarity 213 member B, prostamide/PG F synthase, prostamide/PGF synthase, thioredoxin-type PGF synthase,
• Gene location: 1p36.32 (232606056: 232682780)     Exons: 6     NC_000002.12

Protein Summary

• Protein general information: Q8TBF2  
  • Name: Prostamide/prostaglandin F synthase (Prostamide/PG F synthase) (Prostamide/PGF synthase) (EC 1.11.1.20) (Peroxiredoxin like 2B) (Protein FAM213B)
  • Length: 198  
  • Mass: 21223
• Sequence:

  MSTVDLARVGACILKHAVTGEAVELRSLWREHACVVAGLRRFGCVVCRWIAQDLSSLAGLLDQHGVRLVGVGPEA
  LGLQEFLDGDYFAGELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLV
  VSKGGDKVLLHFVQKSPGDYVPKEHILQVLGISAEVCASDPPQCDREV

• Structural information:
  • Interpro: IPR032801  IPR036249  
  • STRING: ENSP00000413218
• Other Databases: GeneCards:  PRXL2B  Malacards:  PRXL2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0016209	antioxidant activity	IBA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	ISS	molecular function
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0047017	prostaglandin-F synthase activity	ISS	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	ISS	molecular function
GO:0001516	prostaglandin biosynthetic process	ISS	biological process
GO:0043209	myelin sheath	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq