• Gene id: 127262

Gene Summary

• Gene Symbol: TPRG1L   Gene   UCSC   Ensembl
• Aliases: FAM79A, h-mover, mover
• Gene name: tumor protein p63 regulated 1 like
• Alternate names: tumor protein p63-regulated gene 1-like protein, RP11-46F15.3, family with sequence similarity 79, member A, mossy fiber terminal-associated vertebrate-specific presynaptic protein,
• Gene location: 1p36.32 (7306998: 7312462)     Exons: 10     NC_000017.11
• OMIM: 611460

Protein Summary

• Protein general information: Q5T0D9  
  • Name: Tumor protein p63 regulated gene 1 like protein (Mossy fiber terminal associated vertebrate specific presynaptic protein) (Protein FAM79A)
  • Length: 272  
  • Mass: 30212
• Sequence:

  MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAV
  EEIRVVVRPVEDGEIQGVWLLTEVDHWNNEKERLVLVTEQSLLICKYDFISLQCQQVVRIALNAVDTISYGEFQF
  PPKSLNKREGFGIRIQWDKQSRPSFINRWNPWSTNVPYATFTEHPMAGADEKTASLCQLESFKALLIQAVKKAQK
  ESPLPGQANGVLILERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF

• Structural information:
  • Protein Domains: (65..23-)
    (/note="hSac2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01127"-)
  • Interpro: IPR034753  IPR022158  IPR040242  
  • Prosite: PS51791
  • STRING: ENSP00000367595
• Other Databases: GeneCards:  TPRG1L  Malacards:  TPRG1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0044305	calyx of Held	ISS	cellular component
GO:0051966	regulation of synaptic transmission, glutamatergic	ISS	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0008021	synaptic vesicle	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881