• Gene id: 1270

Gene Summary

• Gene Symbol: CNTF   Gene   UCSC   Ensembl
• Aliases: HCNTF
• Gene name: ciliary neurotrophic factor
• Alternate names: ciliary neurotrophic factor, Ciliary Neuronotrophic Factor,
• Gene location: 11q12.1 (58622664: 58625732)     Exons: 2     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival fact
• OMIM: 603196

Protein Summary

• Protein general information: P26441  
  • Name: Ciliary neurotrophic factor (CNTF)
  • Length: 200  
  • Mass: 22931
  • Tissue specificity: Nervous system.
• Sequence:

  MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQE
  NLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGG
  LFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

• Structural information:
  • Interpro: IPR009079  IPR000151  
  • PDB: 1CNT
  • PDBsum: 1CNT
  • DIP: 5776
  • STRING: ENSP00000355370
• Other Databases: GeneCards:  CNTF  Malacards:  CNTF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005127	ciliary neurotrophic factor receptor binding	IBA	molecular function
GO:0008083	growth factor activity	IBA	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0048143	astrocyte activation	IBA	biological process
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IBA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0048680	positive regulation of axon regeneration	IBA	biological process
GO:0005127	ciliary neurotrophic factor receptor binding	IEA	molecular function
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005127	ciliary neurotrophic factor receptor binding	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048666	neuron development	IEA	biological process
GO:0046668	regulation of retinal cell programmed cell death	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0048644	muscle organ morphogenesis	IEA	biological process
GO:0046533	negative regulation of photoreceptor cell differentiation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0008083	growth factor activity	IDA	molecular function
GO:0005138	interleukin-6 receptor binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0005615	extracellular space	IC	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0070120	ciliary neurotrophic factor-mediated signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Keratoconus	PMID:23489213
Huntington's disease	PMID:9121555
Glaucoma	PMID:19060281
Multiple sclerosis	PMID:11890844
Psychotic disorder	PMID:8834105
obesity	PMID:12404108
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray