• Gene id: 1268

Gene Summary

• Gene Symbol: CNR1   Gene   UCSC   Ensembl
• Aliases: CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR
• Gene name: cannabinoid receptor 1
• Alternate names: cannabinoid receptor 1, cannabinoid receptor 1 (brain), central cannabinoid receptor,
• Gene location: 6q15 (88167348: 88139863)     Exons: 8     NC_000006.12
• Gene summary(Entrez): This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protei
• OMIM: 114610

Protein Summary

• Protein general information: P21554  
  • Name: Cannabinoid receptor 1 (CB R) (CB1) (CANN6)
  • Length: 472  
  • Mass: 52858
  • Tissue specificity: Widely expressed, with highest levels in fetal and adult brain. Expression levels of isoform 2 and isoform 3 are much lower than those of isoform 1. {ECO
• Sequence:

  MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQ
  VNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCR
  PSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYK
  RIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
  AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLI
  KTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCI
  KSTVKIAKVTMSVSTDTSAEAL

• Structural information:
  • Interpro: IPR000810  IPR002230  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • PDB: 1LVQ 1LVR 2B0Y 2KOE 2MZ2 2MZ3 2MZA 5TGZ 5U09 5XR8 5XRA 6KQI 6N4B
  • PDBsum: 1LVQ 1LVR 2B0Y 2KOE 2MZ2 2MZ3 2MZA 5TGZ 5U09 5XR8 5XRA 6KQI 6N4B
  • DIP: 61575
  • STRING: ENSP00000358513
• Other Databases: GeneCards:  CNR1  Malacards:  CNR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0019222	regulation of metabolic process	IBA	biological process
GO:0038171	cannabinoid signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004949	cannabinoid receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004949	cannabinoid receptor activity	IDA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004949	cannabinoid receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004949	cannabinoid receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060405	regulation of penile erection	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0051001	negative regulation of nitric-oxide synthase activity	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0038171	cannabinoid signaling pathway	IEA	biological process
GO:0033602	negative regulation of dopamine secretion	IEA	biological process
GO:0033004	negative regulation of mast cell activation	IEA	biological process
GO:0032228	regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0002866	positive regulation of acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0099553	trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0042593	glucose homeostasis	IEA	biological process
GO:0038171	cannabinoid signaling pathway	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0045759	negative regulation of action potential	IEA	biological process
GO:0043271	negative regulation of ion transport	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0031999	negative regulation of fatty acid beta-oxidation	IEA	biological process
GO:0031622	positive regulation of fever generation	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0014063	negative regulation of serotonin secretion	IEA	biological process
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004949	cannabinoid receptor activity	IEA	molecular function
GO:0099635	voltage-gated calcium channel activity involved in positive regulation of presynaptic cytosolic calcium levels	IEA	molecular function
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0098921	retrograde trans-synaptic signaling by endocannabinoid	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0032592	integral component of mitochondrial membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0007413	axonal fasciculation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0004949	cannabinoid receptor activity	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0099703	induction of synaptic vesicle exocytosis by positive regulation of presynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099533	positive regulation of presynaptic cytosolic calcium concentration	IEA	biological process
GO:0038171	cannabinoid signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04714	Thermogenesis
hsa04015	Rap1 signaling pathway
hsa04723	Retrograde endocannabinoid signaling

Diseases

Associated diseases	References
Schizophrenia	PMID:11803524
type 2 diabetes mellitus	PMID:18678611
obesity	PMID:17405839
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray