• Gene id: 1267

Gene Summary

• Gene Symbol: CNP   Gene   UCSC   Ensembl
• Aliases: CNP1
• Gene name: 2',3'-cyclic nucleotide 3' phosphodiesterase
• Alternate names: 2',3'-cyclic-nucleotide 3'-phosphodiesterase, 2', 3' cyclic nucleotide 3' phosphohydrolase, CNPase,
• Gene location: 17q21.2 (41966794: 41977739)     Exons: 5     NC_000017.11
• OMIM: 123830

Protein Summary

• Protein general information: P09543  
  • Name: 2',3' cyclic nucleotide 3' phosphodiesterase (CNP) (CNPase) (EC 3.1.4.37)
  • Length: 421  
  • Mass: 47579
• Sequence:

  MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVIVDKYR
  DGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQYQYQVVLVEP
  KTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQ
  FVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARV
  ELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSL
  GNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII

• Structural information:
  • Interpro: IPR008431  IPR009097  IPR027417  
  • PDB: 1WOJ
  • PDBsum: 1WOJ
  • STRING: ENSP00000377470
• Other Databases: GeneCards:  CNP  Malacards:  CNP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	IEA	molecular function
GO:0009214	cyclic nucleotide catabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	TAS	molecular function
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0035748	myelin sheath abaxonal region	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0005902	microvillus	IEA	cellular component
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	IEA	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0009636	response to toxic substance	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0004113	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity	IEA	molecular function
GO:0046902	regulation of mitochondrial membrane permeability	IEA	biological process
GO:0035749	myelin sheath adaxonal region	IEA	cellular component
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0031143	pseudopodium	IEA	cellular component
GO:0030900	forebrain development	IEA	biological process
GO:0030551	cyclic nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Restless legs syndrome	PMID:21570342
Multiple sclerosis	PMID:19473295
Multiple sclerosis	PMID:18676363
Schizophrenia	PMID:16389193
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)