• Gene id: 1266

Gene Summary

• Gene Symbol: CNN3   Gene   UCSC   Ensembl
• Gene name: calponin 3
• Alternate names: calponin-3, calponin 3, acidic, calponin, acidic isoform, dJ639P13.2.2 (acidic calponin 3),
• Gene location: 1p21.3 (30017029: 30009729)     Exons: 2     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associ
• OMIM: 602374

Protein Summary

• Protein general information: Q15417  
  • Name: Calponin 3 (Calponin, acidic isoform)
  • Length: 329  
  • Mass: 36414
  • Tissue specificity: Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
• Sequence:

  MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNE
  SSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTR
  RFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTR
  RDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
  QAEYPDEYHGEYQDDYPRDYQYSDQGIDY

• Structural information:
  • Protein Domains: (26..13-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044"-)
  • Interpro: IPR001997  IPR000557  IPR001715  IPR036872  IPR003096  
  • Prosite: PS01052 PS51122 PS50021
  • CDD: cd00014
  • STRING: ENSP00000359225
• Other Databases: GeneCards:  CNN3  Malacards:  CNN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular function
GO:0031032	actomyosin structure organization	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0032780	negative regulation of ATPase activity	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0098641	cadherin binding involved in cell-cell adhesion	HDA	molecular function
GO:0005912	adherens junction	HDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0005925	focal adhesion	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)