• Gene id: 126520

Gene Summary

• Gene Symbol: PLK5   Gene   UCSC   Ensembl
• Aliases: PLK-5, PLK5P, SgK384ps
• Gene name: polo like kinase 5 (inactive)
• Alternate names: inactive serine/threonine-protein kinase PLK5, polo-like kinase 5, pseudogene,
• Gene location: 19p13.3 (1524076: 1536045)     Exons: 14     NC_000019.10
• OMIM: 300680

Protein Summary

• Protein general information: Q496M5  
  • Name: Inactive serine/threonine protein kinase PLK5 (Polo like kinase 5) (PLK 5)
  • Length: 336  
  • Mass: 36329
  • Tissue specificity: Expressed in the brain, neurons and glial cells. Also expressed in highly differentiated cells, such as the serous acini in the parotid gland, distal and proximal tubules of the kidney, tubules of the seminal gland, Kupffer cells and s
• Sequence:

  MYTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQGFTPDRLP
  AHSCHSPPIFAIPPPLGRIFRKVGQRLLTQCRPPCPFTPKEASGPGEGGPDPDSMEWDGESSLSAKEVPCLEGPI
  HLVAQGTLQSDLAGPEGSRRPEVEAALRHLQLCLDVGPPATQDPLGEQQPILWAPKWVDYSSKYGFGYQLLDGGR
  TGRHPHGPATPRREGTLPTPVPPAGPGLCLLRFLASEHALLLLFSNGMVQVSFSGVPAQLVLSGEGEGLQLTLWE
  QGSPGTSYSLDVPRSHGCAPTTGQHLHHALRMLQSI

• Structural information:
  • Protein Domains: (1..6-)
    (/note="Protein-kinas)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (259..33-)
    (/note="POLO-box")
  • Interpro: IPR011009  IPR033701  IPR036947  IPR000719  
  • Prosite: PS50011
  • CDD: cd13118
  • STRING: ENSP00000466248
• Other Databases: GeneCards:  PLK5  Malacards:  PLK5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071363	cellular response to growth factor stimulus	IDA	biological process
GO:0002357	defense response to tumor cell	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:2000045	regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq