• Gene id: 126432

Gene Summary

• Gene Symbol: RINL   Gene   UCSC   Ensembl
• Gene name: Ras and Rab interactor like
• Alternate names: ras and Rab interactor-like protein,
• Gene location: 19q13.2 (38878274: 38867824)     Exons: 12     NC_000019.10

Protein Summary

• Protein general information: Q6ZS11  
  • Name: Ras and Rab interactor like protein
  • Length: 566  
  • Mass: 62466
• Sequence:

  MAQPEDKAPEVPTEGVRLVPPQVNKADRTPLGVLSTLEPLTRLQRTWGVWHVPELDTQDAEALVGLWPLGSFLVT
  GRDPSQALVLRSGPLPGEVNTYQIQKIPRGVSLESSNLCMPDLPHLLAFLSASRDVLPRTLLLPPPTLGPRDEHT
  DPVQIGRVQQDTPGKVLSIVNQLYLETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLSPEVDHPG
  PALASLLEEEEEDLEGKEEGREDDPEEEGPEDVLTIHVQSLVRARSSYVARQYRSLRVRIASDSGGPHGSGDPAT
  ELLQDVRHLLTDLQDHLAKDSYIRAVFGSRGPGLPKKDEDPGPALETAVCQAVLAPLKPALWTRLRTLRAPELRR
  LRRRQTALRAGAGPPGAQGPGPEGQSPAPALRSRIHERLAHLHAACAPRRKVALLLEVCRDVYAGLARGENQDPL
  GADAFLPALTEELIWSPDIGDTQLDVEFLMELLDPDELRGEAGYYLTTWFGALHHIAHYQPETDRAPRGLSSEAR
  ASLHQWHRRRTLHRKDHPRAQANLPFKEPWAEETVTGTSDN

• Structural information:
  • Protein Domains: (370..51-)
    (/note="VPS9-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00550"-)
  • Interpro: IPR036860  IPR003123  IPR037191  
  • Prosite: PS51205
  • STRING: ENSP00000467107
• Other Databases: GeneCards:  RINL  Malacards:  RINL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001726	ruffle	ISS	cellular component
GO:0006897	endocytosis	ISS	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	ISS	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881