• Gene id: 126382

Gene Summary

• Gene Symbol: NR2C2AP   Gene   UCSC   Ensembl
• Aliases: TRA16
• Gene name: nuclear receptor 2C2 associated protein
• Alternate names: nuclear receptor 2C2-associated protein, TR4 orphan receptor associated protein TRA16, TR4 orphan receptor-associated 16 kDa protein, repressor for TR4 transactivation,
• Gene location: 19p13.11 (19203413: 19201408)     Exons: 6     NC_000019.10

Protein Summary

• Protein general information: Q86WQ0  
  • Name: Nuclear receptor 2C2 associated protein (TR4 orphan receptor associated 16 kDa protein)
  • Length: 139  
  • Mass: 15876
  • Tissue specificity: Expressed in all tissues examined, with highest expression in heart, skeletal muscle and pancreas. {ECO
• Sequence:

  MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRG
  CLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV

• Structural information:
  • Interpro: IPR008979  IPR033601  
  • STRING: ENSP00000402756
• Other Databases: GeneCards:  NR2C2AP  Malacards:  NR2C2AP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq