• Gene id: 1263

Gene Summary

• Gene Symbol: PLK3   Gene   UCSC   Ensembl
• Aliases: CNK, FNK, PLK-3, PRK
• Gene name: polo like kinase 3
• Alternate names: serine/threonine-protein kinase PLK3, FGF-inducible kinase, cytokine-inducible serine/threonine-protein kinase, proliferation-related kinase,
• Gene location: 1p34.1 (44799951: 44805994)     Exons: 15     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the highly conserved polo-like kinase family of serine/threonine kinases. Members of this family are characterized by an amino-terminal kinase domain and a carboxy-terminal bipartite polo box domain that fun
• OMIM: 608544

Protein Summary

• Protein general information: Q9H4B4  
  • Name: Serine/threonine protein kinase PLK3 (EC 2.7.11.21) (Cytokine inducible serine/threonine protein kinase) (FGF inducible kinase) (Polo like kinase 3) (PLK 3) (Proliferation related kinase)
  • Length: 646  
  • Mass: 71629
  • Tissue specificity: Transcripts are highly detected in placenta, lung, followed by skeletal muscle, heart, pancreas, ovaries and kidney and weakly detected in liver and brain. May have a short half-live. In cells of hematopoietic origin, strongly and excl
• Sequence:

  MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGRTYLKGRLLGKGGFAR
  CYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHI
  WKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPN
  YVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
  DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKNHAQERDEVSGLVSGL
  MRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCIAFMPPAEQ
  NPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRAL
  QPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
  LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA

• Structural information:
  • Protein Domains: (62..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (470..53-)
    1 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00154-)
    (567..63-)
    2 (/note="POLO-box)
    (/evidence="ECO:0000255|PROSITE-ProR-)
  • Interpro: IPR011009  IPR042703  IPR033701  IPR033695  IPR000959   IPR036947  IPR000719  IPR017441  IPR008271  IPR020658  
  • Prosite: PS50078 PS00107 PS50011 PS00108
  • CDD: cd13118 cd13117 cd14189
  • PDB: 4B6L
  • PDBsum: 4B6L
  • STRING: ENSP00000361275
• Other Databases: GeneCards:  PLK3  Malacards:  PLK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904716	positive regulation of chaperone-mediated autophagy	IDA	biological process
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0044819	mitotic G1/S transition checkpoint	IBA	biological process
GO:0000922	spindle pole	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0090166	Golgi disassembly	IBA	biological process
GO:2000777	positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved in cellular response to hypoxia	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005795	Golgi stack	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0002039	p53 binding	IDA	molecular function
GO:0000302	response to reactive oxygen species	IDA	biological process
GO:0090166	Golgi disassembly	IDA	biological process
GO:0090166	Golgi disassembly	IDA	biological process
GO:0051302	regulation of cell division	IDA	biological process
GO:0009314	response to radiation	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006970	response to osmotic stress	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0043491	protein kinase B signaling	ISS	biological process
GO:0031122	cytoplasmic microtubule organization	IMP	biological process
GO:0007113	endomitotic cell cycle	TAS	biological process
GO:0007093	mitotic cell cycle checkpoint	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0032465	regulation of cytokinesis	TAS	biological process
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0044819	mitotic G1/S transition checkpoint	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04068	FoxO signaling pathway
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
ovary epithelial cancer	PMID:14970859
Breast carcinoma	PMID:15785925
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq