• Gene id: 126282

Gene Summary

• Gene Symbol: TNFAIP8L1   Gene   UCSC   Ensembl
• Aliases: TIPE1
• Gene name: TNF alpha induced protein 8 like 1
• Alternate names: tumor necrosis factor alpha-induced protein 8-like protein 1, TNF alpha-induced protein 8-like protein 1, TNFAIP8-like protein 1, oxidative stress-regulated gene-beta, oxy-beta, tumor necrosis factor, alpha induced protein 8 like 1, tumor necrosis factor, alpha,
• Gene location: 19p13.3 (48921710: 49036692)     Exons: 39     NC_000020.11
• OMIM: 615869

Protein Summary

• Protein general information: Q8WVP5  
  • Name: Tumor necrosis factor alpha induced protein 8 like protein 1 (TIPE1) (TNF alpha induced protein 8 like protein 1) (TNFAIP8 like protein 1) (Oxidative stress regulated gene beta) (Oxy beta)
  • Length: 186  
  • Mass: 20827
  • Tissue specificity: High expression detected in most carcinoma cell lines, especially in cells transformed with virus genomes. {ECO
• Sequence:

  MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLR
  GDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAAGLLECRDLLHQAVGPHLTAKSHGRINHVFGHL
  ADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

• Structural information:
  • Interpro: IPR008477  IPR038355  
  • STRING: ENSP00000444215
• Other Databases: GeneCards:  TNFAIP8L1  Malacards:  TNFAIP8L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0032007	negative regulation of TOR signaling	IBA	biological process
GO:0032007	negative regulation of TOR signaling	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0032007	negative regulation of TOR signaling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray