• Gene id: 126272

Gene Summary

• Gene Symbol: EID2B   Gene   UCSC   Ensembl
• Aliases: EID-2B, EID-3
• Gene name: EP300 interacting inhibitor of differentiation 2B
• Alternate names: EP300-interacting inhibitor of differentiation 2B, EID-2-like inhibitor of differentiation-3,
• Gene location: 19q13.2 (39532851: 39530986)     Exons: 1     NC_000019.10
• OMIM: 617355

Protein Summary

• Protein general information: Q96D98  
  • Name: EP300 interacting inhibitor of differentiation 2B (EID 2B) (EID 2 like inhibitor of differentiation 3) (EID 3)
  • Length: 161  
  • Mass: 16985
• Sequence:

  MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPSSVPGL
  ASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMDFAAVAFTVAL
  TASEALSPLAD

• Structural information:
  • Interpro: IPR033258  IPR033259  
  • STRING: ENSP00000317564
• Other Databases: GeneCards:  EID2B  Malacards:  EID2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045662	negative regulation of myoblast differentiation	IDA	biological process
GO:0005634	nucleus	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881