• Gene id: 126014

Gene Summary

• Gene Symbol: OSCAR   Gene   UCSC   Ensembl
• Aliases: PIGR3, PIgR-3
• Gene name: osteoclast associated Ig-like receptor
• Alternate names: osteoclast-associated immunoglobulin-like receptor, osteoclast associated receptor OSCAR-S1, osteoclast associated receptor OSCAR-S2, osteoclast associated, immunoglobulin-like receptor, poly-Ig receptor 3, polymeric immunoglobulin receptor 3,
• Gene location: 19q13.42 (54102685: 54094667)     Exons: 7     NC_000019.10
• Gene summary(Entrez): Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the
• OMIM: 615046

Protein Summary

• Protein general information: Q8IYS5  
  • Name: Osteoclast associated immunoglobulin like receptor (Osteoclast associated receptor) (hOSCAR) (Polymeric immunoglobulin receptor 3) (PIgR 3) (PIgR3) (Poly Ig receptor 3)
  • Length: 282  
  • Mass: 30481
• Sequence:

  MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLF
  RDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRC
  AGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEAR
  PASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV

• Structural information:
  • Protein Domains: (22..11-)
    (/note="Ig-like-1)
    (126..21-)
    (/note="Ig-like-2")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • PDB: 5CJ8 5CJB 5EIQ 5EIV
  • PDBsum: 5CJ8 5CJB 5EIQ 5EIV
  • STRING: ENSP00000479089
• Other Databases: GeneCards:  OSCAR  Malacards:  OSCAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038064	collagen receptor activity	IDA	molecular function
GO:0038064	collagen receptor activity	IMP	molecular function
GO:0030316	osteoclast differentiation	IMP	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0038065	collagen-activated signaling pathway	IEA	biological process
GO:0038065	collagen-activated signaling pathway	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038064	collagen receptor activity	IDA	molecular function
GO:0038064	collagen receptor activity	IMP	molecular function
GO:0030316	osteoclast differentiation	IMP	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0038065	collagen-activated signaling pathway	IEA	biological process
GO:0038065	collagen-activated signaling pathway	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq