• Gene id: 1260

Gene Summary

• Gene Symbol: CNGA2   Gene   UCSC   Ensembl
• Aliases: CNCA, CNCA1, CNG2, OCNC1, OCNCALPHA, OCNCa
• Gene name: cyclic nucleotide gated channel subunit alpha 2
• Alternate names: cyclic nucleotide-gated olfactory channel, CNG channel alpha-2, cyclic nucleotide gated channel alpha 2, cyclic-nucleotide-gated cation channel 2,
• Gene location: Xq28 (183162760: 183122214)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene represents the alpha subunit of a cyclic nucleotide-gated olfactory channel. The encoded protein contains a carboxy-terminal leucine zipper that mediates channel formation. [provided by RefSeq, Jan 2010]
• OMIM: 300338

Protein Summary

• Protein general information: Q16280  
  • Name: Cyclic nucleotide gated olfactory channel (Cyclic nucleotide gated cation channel 2) (Cyclic nucleotide gated channel alpha 2) (CNG channel alpha 2) (CNG 2) (CNG2)
  • Length: 664  
  • Mass: 76048
• Sequence:

  MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQQGRSGFRRIVRLVGI
  IREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGEDKGTKKKFELFVLDPAGDWYYCWLFVIAMP
  VLYNWCLLVARACFSDLQKGYYLVWLVLDYVSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDV
  ASIIPTDLIYFAVDIHSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSI
  GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIFATIVGNVGSMI
  SNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNKKTVDEREILKNLPAKLRAEIAINVHLSTLK
  KVRIFHDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISIL
  NIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
  LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAAADEP

• Structural information:
  • Interpro: IPR032406  IPR018490  IPR018488  IPR000595  IPR005821   IPR014710  
  • Prosite: PS00888 PS00889 PS50042
  • CDD: cd00038
  • STRING: ENSP00000328478
• Other Databases: GeneCards:  CNGA2  Malacards:  CNGA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005223	intracellular cGMP-activated cation channel activity	IBA	molecular function
GO:0030553	cGMP binding	IBA	molecular function
GO:0005222	intracellular cAMP-activated cation channel activity	IBA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0030552	cAMP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0060170	ciliary membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0030660	Golgi-associated vesicle membrane	TAS	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R