• Gene id: 125206

Gene Summary

• Gene Symbol: SLC5A10   Gene   UCSC   Ensembl
• Aliases: SGLT-5, SGLT5
• Gene name: solute carrier family 5 member 10
• Alternate names: sodium/glucose cotransporter 5, Na(+)/glucose cotransporter 5, solute carrier family 5 (sodium/glucose cotransporter), member 10, solute carrier family 5 (sodium/sugar cotransporter), member 10,
• Gene location: 17p11.2 (18950675: 19022594)     Exons: 17     NC_000017.11
• Gene summary(Entrez): This gene is a member of the sodium/glucose transporter family. Members of this family are sodium-dependent transporters and can be divided into two subfamilies based on sequence homology, one that co-transports sugars and the second that transports molec
• OMIM: 600724

Protein Summary

• Protein general information: A0PJK1  
  • Name: Sodium/glucose cotransporter 5 (Na(+)/glucose cotransporter 5) (Solute carrier family 5 member 10)
  • Length: 596  
  • Mass: 64342
  • Tissue specificity: Seems to be exclusively expressed in kidney. {ECO
• Sequence:

  MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWWPIGASLFASSEGSGL
  FIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTLPEYIQKRYGGQRIRMYLSVLSLLLSVFTKI
  SLDLYAGALFVHICLGWNFYLSTILTLGITALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLE
  AAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAG
  SILASYLKMLPMGLIIMPGMISRALFPDDVGCVVPSECLRACGAEVGCSNIAYPKLVMELMPIGLRGLMIAVMLA
  ALMSSLTSIFNSSSTLFTMDIWRRLRPRSGERELLLVGRLVIVALIGVSVAWIPVLQDSNSGQLFIYMQSVTSSL
  APPVTAVFVLGVFWRRANEQGAFWGLIAGLVVGATRLVLEFLNPAPPCGEPDTRPAVLGSIHYLHFAVALFALSG
  AVVVAGSLLTPPPQSVQIENLTWWTLAQDVPLGTKAGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA

• Structural information:
  • Interpro: IPR038377  IPR001734  IPR018212  
  • Prosite: PS00457 PS50283
  • STRING: ENSP00000379008
• Other Databases: GeneCards:  SLC5A10  Malacards:  SLC5A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005412	glucose:sodium symporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0015370	solute:sodium symporter activity	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq