• Gene id: 125061

Gene Summary

• Gene Symbol: AFMID   Gene   UCSC   Ensembl
• Aliases: FKF, KF, KFA
• Gene name: arylformamidase
• Alternate names: kynurenine formamidase, KFase, N-formylkynurenine formamidase, probable arylformamidase,
• Gene location: 17q25.3 (78185101: 78207701)     Exons: 14     NC_000017.11
• OMIM: 609659

Protein Summary

• Protein general information: Q63HM1  
  • Name: Kynurenine formamidase (KFA) (KFase) (EC 3.5.1.9) (Arylformamidase) (N formylkynurenine formamidase) (FKF)
  • Length: 303  
  • Mass: 33992
• Sequence:

  MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGDGEGEK
  VDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQK
  RYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTLEDAQRNSPQL
  KVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
  IFQ

• Structural information:
  • Interpro: IPR029058  IPR013094  IPR027519  
  • STRING: ENSP00000328938
• Other Databases: GeneCards:  AFMID  Malacards:  AFMID

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019441	tryptophan catabolic process to kynurenine	IBA	biological process
GO:0016787	hydrolase activity	IBA	molecular function
GO:0009056	catabolic process	IBA	biological process
GO:0009435	NAD biosynthetic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004061	arylformamidase activity	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process
GO:0004061	arylformamidase activity	IEA	molecular function
GO:0006569	tryptophan catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004061	arylformamidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006569	tryptophan catabolic process	IEA	biological process
GO:0034354	'de novo' NAD biosynthetic process from tryptophan	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004061	arylformamidase activity	IEA	molecular function
GO:0019441	tryptophan catabolic process to kynurenine	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00630	Glyoxylate and dicarboxylate metabolism
hsa00380	Tryptophan metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq