• Gene id: 124783

Gene Summary

• Gene Symbol: SPATA32   Gene   UCSC   Ensembl
• Aliases: AEP2, C17orf46, TEX34, VAD1.2
• Gene name: spermatogenesis associated 32
• Alternate names: spermatogenesis-associated protein 32, CTD-2020K17.4, acrosome expressed 2, testis expressed 34, testis-expressed protein 34, testis-expressed sequence 34 protein,
• Gene location: 17q21.31 (45262093: 45254392)     Exons: 5     NC_000017.11
• OMIM: 0

Protein Summary

• Protein general information: Q96LK8  
  • Name: Spermatogenesis associated protein 32 (Testis expressed protein 34)
  • Length: 384  
  • Mass: 42325
  • Tissue specificity: Detected in testis, and on the acrosomal cap of spermatids.
• Sequence:

  MGVTGAHGFPCCGKGSVEVAEMRDDLSQHQIQEEQELEADMLEQKPQLQVDLDLDPDPDPDPELEIGQVPALLES
  ELYPALKLEAELDTEANSNEESDFEEPMQLVCKIESVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSIS
  AQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPLREAIPTNALCSEEQLQIPDAHSAPPTTSSQAPS
  PLLSSDLPPPIDLTELITFASSLAMASSSRMDLPSLEHMMKAPPQEALEPSTEPLLTTVEEREPENHAETLPEKP
  REARAPLKSWSQEDKNFAQSYFDFSKPGIKRATIKGQIQLLQPPATSPLLQGSKEDSVPPGKEKENPLLVKIHFK
  LSAPTIPEK

• Structural information:
  • Interpro: IPR029297  
  • STRING: ENSP00000331532
• Other Databases: GeneCards:  SPATA32  Malacards:  SPATA32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IBA	molecular function
GO:0007283	spermatogenesis	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IBA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
May be involved in acrosome formation during spermiogenesis	MIK: 18621766
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq