• Gene id: 124626

Gene Summary

• Gene Symbol: ZPBP2   Gene   UCSC   Ensembl
• Aliases: ZPBPL
• Gene name: zona pellucida binding protein 2
• Alternate names: zona pellucida-binding protein 2, ZPBP-like protein,
• Gene location: 17q21.1 (39868163: 39877895)     Exons: 8     NC_000017.11
• OMIM: 608499

Protein Summary

• Protein general information: Q6X784  
  • Name: Zona pellucida binding protein 2 (ZPBP like protein)
  • Length: 338  
  • Mass: 38652
  • Tissue specificity: Expressed specifically in testis. {ECO
• Sequence:

  MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGP
  NEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRF
  TTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVD
  CEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCS
  PATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED

• Structural information:
  • Interpro: IPR007110  IPR013783  IPR010857  
  • STRING: ENSP00000335384
• Other Databases: GeneCards:  ZPBP2  Malacards:  ZPBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002199	zona pellucida receptor complex	IBA	cellular component
GO:0007339	binding of sperm to zona pellucida	IBA	biological process
GO:0001675	acrosome assembly	IBA	biological process
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002199	zona pellucida receptor complex	IEA	cellular component
GO:0002638	negative regulation of immunoglobulin production	IEA	biological process
GO:0006665	sphingolipid metabolic process	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0046466	membrane lipid catabolic process	IEA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001675	acrosome assembly	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881