• Gene id: 124599

Gene Summary

• Gene Symbol: CD300LB   Gene   UCSC   Ensembl
• Aliases: CD300b, CLM-7, CLM7, CMRF35-A2, IREM-3, IREM3, TREM-5, TREM5
• Gene name: CD300 molecule like family member b
• Alternate names: CMRF35-like molecule 7, CD300 antigen like family member B, immune receptor expressed on myeloid cells 3, leukocyte mono-Ig-like receptor 5, triggering receptor expressed on myeloid cells 5,
• Gene location: 17q25.1 (74531474: 74521173)     Exons: 4     NC_000017.11
• Gene summary(Entrez): CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).[supplied by OMIM, Mar 2008]
• OMIM: 612584

Protein Summary

• Protein general information: A8K4G0  
  • Name: CMRF35 like molecule 7 (CLM 7) (CD300 antigen like family member B) (CMRF35 A2) (Immune receptor expressed on myeloid cells 3) (IREM 3) (Leukocyte mono Ig like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM 5) (CD antigen CD300b)
  • Length: 201  
  • Mass: 22689
  • Tissue specificity: Expressed exclusively in myeloid lineages. {ECO
• Sequence:

  MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDR
  VSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH
  YMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT

• Structural information:
  • Protein Domains: (18..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000376397
• Other Databases: GeneCards:  CD300LB  Malacards:  CD300LB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq