• Gene id: 124512

Gene Summary

• Gene Symbol: METTL23   Gene   UCSC   Ensembl
• Aliases: C17orf95, MRT44
• Gene name: methyltransferase like 23
• Alternate names: methyltransferase-like protein 23, spike binding protein 1,
• Gene location: 17q25.1 (76726040: 76733880)     Exons: 7     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene functions as a transcription factor regulator in the transcriptional pathway for human cognition. It is a partner of the alpha subunit of the GA-binding protein transcription factor. Mutations in this gene cause mild autos
• OMIM: 615262

Protein Summary

• Protein general information: Q86XA0  
  • Name: Methyltransferase like protein 23 (EC 2.1.1. )
  • Length: 190  
  • Mass: 21469
• Sequence:

  MYVWPCAVVLAQYLWFHRRSLPGKAILEIGAGVSLPGILAAKCGAEVILSDSSELPHCLEVCRQSCQMNNLPHLQ
  VVGLTWGHISWDLLALPPQDIILASDVFFEPEDFEDILATIYFLMHKNPKVQLWSTYQVRSADWSLEALLYKWDM
  KCVHIPLESFDADKEDIAESTLPGRHTVEMLVISFAKDSL

• Structural information:
  • Interpro: IPR019410  IPR029063  
  • STRING: ENSP00000482599
• Other Databases: GeneCards:  METTL23  Malacards:  METTL23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032259	methylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0050890	cognition	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)